PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00011.1.g05210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 277aa    MW: 29952.2 Da    PI: 5.0604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00011.1.g05210.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-152269148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g W++eEde+l + +++ G  tW+++a+  g++R++k+c++rw +yl
  Zjn_sc00011.1.g05210.1.am.mk 22 KGLWSPEEDERLFNQITMRGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69
                                  678*******************************************97 PP

2Myb_DNA-binding42.91.2e-1375118146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   +g+ ++ E+ +++ + + lG++ W++Ia++m+ gRt++++k++w++
  Zjn_sc00011.1.g05210.1.am.mk  75 KGPISKREEMIIISLQQSLGNR-WSAIAAKMP-GRTDNEIKNYWNS 118
                                   6788999***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1241773IPR017930Myb domain
SMARTSM007178.3E-102171IPR001005SANT/Myb domain
SuperFamilySSF466895.47E-2721116IPR009057Homeodomain-like
PfamPF002495.4E-132269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-202376IPR009057Homeodomain-like
CDDcd001671.86E-82569No hitNo description
SMARTSM007172.7E-1374122IPR001005SANT/Myb domain
PROSITE profilePS5129416.38374124IPR017930Myb domain
PfamPF002496.6E-1275118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2477124IPR009057Homeodomain-like
CDDcd001674.12E-1077117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVRKPSQHDV DADRTGENKE RKGLWSPEED ERLFNQITMR GVSTWSSVAQ LAGLRRSGKS  60
CRLRWMNYLR PDLKKGPISK REEMIIISLQ QSLGNRWSAI AAKMPGRTDN EIKNYWNSRI  120
RKRLTAAKKA GSTTTNSAEE PSAPPAAGDE KEESTDNAGT AAATLPIPAR FPVFACQLLD  180
GSGAAALQSP TTTTTTTQQQ NSSSEESKAS VGDGGEDAYH CSAAVGGGDS SIMGHDFLAF  240
DELEYQADLL VDLPGVMDAW ESELYSASSA NSMGSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-252212427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794387e-90HF679438.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB32 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.11e-106PREDICTED: transcription factor MYB82-like
TrEMBLK3XL221e-106K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-48myb domain protein 86